PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011096864.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family TALE
Protein Properties Length: 398aa    MW: 45431.1 Da    PI: 6.9046
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011096864.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox25.72e-083173551854
                     HHHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  18 lFek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     +F++  ++yp+ +e+  LA k gLt +qV++WF N R +
  XP_011096864.1 317 MFQNflHPYPKDAEKHLLALKSGLTRNQVSNWFINARVR 355
                     5887779******************************88 PP

2BELL69.94.6e-23191259372
            BELL   3 qelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     +  ++kk +Ll ll+ Vd+rY+++ ++++tv s+F+av++l++ ++++++Al  iS+ +++L+++i++++
  XP_011096864.1 191 RTSESKKKHLLALLQVVDERYNRCLDEIHTVTSAFHAVTELDP-NLHARFALPMISFMYKNLRERISSHV 259
                     56789**************************************.**********************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.8E-18123257IPR006563POX domain
PfamPF075265.9E-23129256IPR006563POX domain
PROSITE profilePS5007110.981296359IPR001356Homeobox domain
CDDcd000861.44E-10299360No hitNo description
SMARTSM003893.7E-5299363IPR001356Homeobox domain
SuperFamilySSF466891.88E-15300368IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.2E-26302365IPR009057Homeodomain-like
PfamPF059201.6E-14316355IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0009640Biological Processphotomorphogenesis
GO:0010073Biological Processmeristem maintenance
GO:0010227Biological Processfloral organ abscission
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010371Biological Processregulation of gibberellin biosynthetic process
GO:0090470Biological Processshoot organ boundary specification
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 398 aa     Download sequence    Send to blast
MSYGYEGVPY DTSTRWDFSK FINPPEPVGR VTGSCPLSEW MMTEQEALNS NSRGSSRFSN  60
ELSLSLATSE PSVVHGSCIL EQCSEMSSSG VTRYSLPNGH VLSEHASRSG SDVSLSFDSY  120
KPLHLSPLLP GSRFVHAMQE ILAEIAGYAL ENIEQMSYSA DQIGDGVNVS FSSSLDGENT  180
FMYRNNVLQE RTSESKKKHL LALLQVVDER YNRCLDEIHT VTSAFHAVTE LDPNLHARFA  240
LPMISFMYKN LRERISSHVL AVGAHMSKGE ATEETALETC FIHKQWALQQ LYKRDHQFWR  300
PQRGLPERSV SVLRAWMFQN FLHPYPKDAE KHLLALKSGL TRNQVSNWFI NARVRLWKPM  360
IEEMYAEMNR RKGHRNDEET GGDHRNHKGF ESRRFTTE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A7e-15305363563Homeobox protein Meis2
3k2a_B7e-15305363563Homeobox protein Meis2
4xrm_A6e-15305363563Homeobox protein Meis2
4xrm_B6e-15305363563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011096864.10.0PREDICTED: homeobox protein ATH1 isoform X1
SwissprotP487311e-104ATH1_ARATH; Homeobox protein ATH1
TrEMBLF6H3951e-145F6H395_VITVI; Putative uncharacterized protein
STRINGVIT_04s0008g00880.t011e-145(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA82612327
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32980.11e-103homeobox gene 1